DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and hes5.2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001037974.1 Gene:hes5.2 / 733755 XenbaseID:XB-GENE-876635 Length:158 Species:Xenopus tropicalis


Alignment Length:179 Identity:51/179 - (28%)
Similarity:82/179 - (45%) Gaps:47/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVMKPLLERKRRARINKCLDELKDLMAECV--AQTGDAKFEKADILEVTVQHLR-KLKESKKHVP 76
            |:.||::|:.||.|||..:::||.|: |.|  .|..:.|.|||||||:||.:|| :..:.|..:|
 Frog    20 KLRKPVVEKMRRDRINSSIEQLKGLL-ETVFHKQQPNVKLEKADILEMTVTYLRQQTLQIKSEIP 83

  Fly    77 ANP--EQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPLSI 139
            .|.  :..::.||.|...||                         ::.|....:||:        
 Frog    84 HNNDIQMDYKDGYSRCFEEV-------------------------IDFLSLHQKQPE-------- 115

  Fly   140 VCGSSSSSSTYSSASSCSSIS--PVSSGYASDNESLLQISSPGQVWRPW 186
               ::...|.:.|.::.||||  |:.   .|.:::.....|...:||||
 Frog   116 ---TAKLISHFHSKATASSISSFPIR---CSQSKTANGTGSSSSLWRPW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 27/60 (45%)
ORANGE 81..125 CDD:128787 6/43 (14%)
hes5.2NP_001037974.1 bHLH-O_HES5 20..77 CDD:381467 27/57 (47%)
ORANGE 90..128 CDD:128787 10/73 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.