DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Hes3

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_073178.1 Gene:Hes3 / 64628 RGDID:621339 Length:175 Species:Rattus norvegicus


Alignment Length:205 Identity:56/205 - (27%)
Similarity:87/205 - (42%) Gaps:69/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LERKRRARINKCLDELKDLMAECVA-QTGDAKFEKADILEVTVQHLRKLKESKKH---VPANPE- 80
            :|:|||||||..|::|:.|:....: |....|.|||||||::|:::|.|:.|.:.   ||:..: 
  Rat     1 MEKKRRARINLSLEQLRSLLERHYSHQIRKRKLEKADILELSVKYVRSLQNSLQGLWLVPSGVDY 65

  Fly    81 -QSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPLSIV--CG 142
             ..||.|              ||      |:          :|..:|.|....:..||.:.  .|
  Rat    66 PSGFRGG--------------LP------GS----------SQRLRPGEDDSGLRCPLLLQRRAG 100

  Fly   143 SSSSSSTYSSASSCSSISPV------SSGYASDNES-------LLQISS---------------- 178
            |::.|:...:||..|...|.      .:|.:...:|       ||:.|:                
  Rat   101 STTDSANPQTASVLSPCLPAIWAPGPPAGGSQSPQSPFPPLGGLLESSTGILAPPPASNCQAENP 165

  Fly   179 -PG-QVWRPW 186
             || :|||||
  Rat   166 RPGFRVWRPW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 24/52 (46%)
ORANGE 81..125 CDD:128787 7/43 (16%)
Hes3NP_073178.1 bHLH-O_HES3 1..55 CDD:381503 24/53 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..175 10/50 (20%)
WRPW motif 172..175 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334562
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.