Sequence 1: | NP_536753.1 | Gene: | E(spl)m7-HLH / 43160 | FlyBaseID: | FBgn0002633 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_073178.1 | Gene: | Hes3 / 64628 | RGDID: | 621339 | Length: | 175 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 56/205 - (27%) |
---|---|---|---|
Similarity: | 87/205 - (42%) | Gaps: | 69/205 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 LERKRRARINKCLDELKDLMAECVA-QTGDAKFEKADILEVTVQHLRKLKESKKH---VPANPE- 80
Fly 81 -QSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPLSIV--CG 142
Fly 143 SSSSSSTYSSASSCSSISPV------SSGYASDNES-------LLQISS---------------- 178
Fly 179 -PG-QVWRPW 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m7-HLH | NP_536753.1 | HLH | 13..73 | CDD:238036 | 24/52 (46%) |
ORANGE | 81..125 | CDD:128787 | 7/43 (16%) | ||
Hes3 | NP_073178.1 | bHLH-O_HES3 | 1..55 | CDD:381503 | 24/53 (45%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 124..175 | 10/50 (20%) | |||
WRPW motif | 172..175 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334562 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.840 |