Sequence 1: | NP_536753.1 | Gene: | E(spl)m7-HLH / 43160 | FlyBaseID: | FBgn0002633 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571697.2 | Gene: | hey2 / 58146 | ZFINID: | ZDB-GENE-000526-1 | Length: | 324 | Species: | Danio rerio |
Alignment Length: | 281 | Identity: | 66/281 - (23%) |
---|---|---|---|
Similarity: | 98/281 - (34%) | Gaps: | 120/281 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKES--KKHVP 76
Fly 77 ANP-EQSFRA-GYIRAANEVSRALASLPRVDVA--FGTTLMTHLGMRLNQLE------------- 124
Fly 125 -----------QPM---------------------EQPQ-------------------------- 131
Fly 132 ---------------------AVNTPLSIVCG----------SSSSSSTYSSASSCSSISPVSSG 165
Fly 166 YASDNESLLQISSPGQVWRPW 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m7-HLH | NP_536753.1 | HLH | 13..73 | CDD:238036 | 25/60 (42%) |
ORANGE | 81..125 | CDD:128787 | 13/70 (19%) | ||
hey2 | NP_571697.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..34 | ||
HLH | 49..105 | CDD:238036 | 25/55 (45%) | ||
Hairy_orange | 125..162 | CDD:284859 | 10/36 (28%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 294..324 | 12/36 (33%) | |||
YRPW motif | 314..317 | 1/2 (50%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573722 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |