DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and hey2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_571697.2 Gene:hey2 / 58146 ZFINID:ZDB-GENE-000526-1 Length:324 Species:Danio rerio


Alignment Length:281 Identity:66/281 - (23%)
Similarity:98/281 - (34%) Gaps:120/281 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKES--KKHVP 76
            ||..:.::|::||.|||..|.||:.|:.....:.|.||.|||:||::||.||:.|:.:  |.:..
Zfish    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFD 113

  Fly    77 ANP-EQSFRA-GYIRAANEVSRALASLPRVDVA--FGTTLMTHLGMRLNQLE------------- 124
            |:. ...|.: |:.....||:|.|:|:..:|.:  ....|::||....:|.|             
Zfish   114 AHSLAMDFLSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSSCASQREAAAMTTSIAHHQQ 178

  Fly   125 -----------QPM---------------------EQPQ-------------------------- 131
                       .|:                     |.||                          
Zfish   179 ALHPHHWAAALHPIPAAFLQQSGLPSSESSSGRLSEAPQRGAALFSHSDSALRAPSTGSVAPCVP 243

  Fly   132 ---------------------AVNTPLSIVCG----------SSSSSSTYSSASSCSSISPVSSG 165
                                 |...|||...|          ||.:|||.||:.|.|:.|..|||
Zfish   244 PLSTSLLSLSATVHAAAAAAAAQTFPLSFPAGFPLFSPSVTASSVASSTVSSSVSTSTTSQQSSG 308

  Fly   166 YASDNESLLQISSPGQVWRPW 186
                        |..:.:|||
Zfish   309 ------------SSSKPYRPW 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 25/60 (42%)
ORANGE 81..125 CDD:128787 13/70 (19%)
hey2NP_571697.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
HLH 49..105 CDD:238036 25/55 (45%)
Hairy_orange 125..162 CDD:284859 10/36 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..324 12/36 (33%)
YRPW motif 314..317 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573722
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.