DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her7

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021331987.1 Gene:her7 / 58132 ZFINID:ZDB-GENE-000427-6 Length:221 Species:Danio rerio


Alignment Length:194 Identity:50/194 - (25%)
Similarity:86/194 - (44%) Gaps:19/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPLLERKRRARINKCLDELKDLMAECVA--QTGDAKFEKADILEVTVQHLRKLKESKKH 74
            ::.|::||.:||:||.|:|:.|:.||.|:.:...  |....:.|||:|||.||..|:|..::.|.
Zfish    27 RFLKLLKPQVERRRRERMNRSLENLKLLLLQGPEHNQPNQRRLEKAEILEYTVLFLQKANKASKE 91

  Fly    75 VPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTL---MTHLGMRL----NQLEQPME---- 128
            .....:..|..|:.....:.:|.|.....::.:..:.|   :.|..:||    :..:|..|    
Zfish    92 EEGEEKSQFMEGFSSCLQKAARFLLEEGGLEGSVTSMLCQRLAHPTIRLPVRGHSRKQHAESNPQ 156

  Fly   129 ----QPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQ--VWRPW 186
                :|...||.......|:..::....||..:..|..|:...|..:...:...|..  |||||
Zfish   157 HHARRPHHKNTVSKAGHPSACRNTKEPQASRAAFRSTDSNTKHSTAQPTSRHPEPASQTVWRPW 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 24/61 (39%)
ORANGE 81..125 CDD:128787 8/50 (16%)
her7XP_021331987.1 Hairy_orange 100..135 CDD:311465 5/34 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573666
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.