DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her8.2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:213 Identity:69/213 - (32%)
Similarity:98/213 - (46%) Gaps:34/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATKYEMS------KTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEV 60
            |||.:.:      .:.:.||:.|||:|||||.|||.|||:|::.:. .|.:...:|.|||||||:
Zfish     5 ATKLQQNSCQLHISSKEERKLRKPLIERKRRERINLCLDQLRETVV-AVFKPDQSKLEKADILEM 68

  Fly    61 TVQHLRKLKESKKHVP---ANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQ 122
            ||:||:.::.|:...|   ....|.:..|||:...||...|.|...:|...|:.|:.||...|  
Zfish    69 TVKHLQNIQSSRVSDPVLNTGARQRYSTGYIQCMQEVHNLLHSCDWMDKTLGSRLLNHLFKSL-- 131

  Fly   123 LEQPMEQPQAVNTPLSIVCGSSSSSSTYSS--ASSCSSISPVSSG-------YASDNESLLQISS 178
               |:........|.:.:....|..|.|||  ....:|..|.||.       ..|.|:....|..
Zfish   132 ---PLSAKDCPRLPKTSLTSVPSDHSEYSSFHVDETASPKPCSSSPFLCKRPNQSQNQHFTPIRM 193

  Fly   179 PG----------QVWRPW 186
            |.          |:||||
Zfish   194 PHDVESSHLSVLQMWRPW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 31/59 (53%)
ORANGE 81..125 CDD:128787 14/43 (33%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 30/57 (53%)
Hairy_orange 94..132 CDD:284859 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573658
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.