DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her13

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001017901.1 Gene:her13 / 550600 ZFINID:ZDB-GENE-050228-1 Length:224 Species:Danio rerio


Alignment Length:203 Identity:56/203 - (27%)
Similarity:91/203 - (44%) Gaps:33/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESKKH---- 74
            ||..||::|:|||||||:.|.:|:.|:.....||   |.|.|::||:||:.:..:.:|:..    
Zfish    25 RKTRKPIVEKKRRARINESLQDLRTLLTNNDLQT---KMENAEVLELTVKRVESILQSRSQETGT 86

  Fly    75 VPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHL--GMRLNQ----------LEQP- 126
            |.....:.|.||||:..:||...:::.|.::......|:.||  .|.||:          :.:| 
Zfish    87 VTQEASERFAAGYIQCMHEVHTFVSTCPGIEARVAAELLNHLLESMPLNENHLHEMIKDLISEPS 151

  Fly   127 -----MEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSI--------SPVSSGYASDNESLLQISS 178
                 .:..:|.|.....|.|.||....:.|...|..:        :...|..|.|......::.
Zfish   152 SSGDSWQSGEAQNPGRHCVSGMSSELPQFLSNPFCDDLCSDLDETETEERSASAEDTLDFSMVTH 216

  Fly   179 PGQVWRPW 186
            ...:||||
Zfish   217 SKFMWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 25/58 (43%)
ORANGE 81..125 CDD:128787 14/55 (25%)
her13NP_001017901.1 HLH 22..71 CDD:238036 23/48 (48%)
Hairy_orange 95..133 CDD:284859 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573616
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.