DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and HES2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:178 Identity:56/178 - (31%)
Similarity:85/178 - (47%) Gaps:19/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTVQHLRKLKESKKH 74
            :.||.:|||||::||||||:.|.:||.|:...:.:...  :|.||||:||:||:.|::|..|...
Human    12 ELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWP 76

  Fly    75 VPAN-PEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPLS 138
            ..|. |..|:|.||......::|.|.:...::.|....|:.||..|            |.:..|.
Human    77 TAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRR------------AASATLD 129

  Fly   139 IVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW 186
            ......||..:..:.:..|:..|.|:...|...   ....|| :||||
Human   130 GGRAGDSSGPSAPAPAPASAPEPASAPVPSPPS---PPCGPG-LWRPW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 29/61 (48%)
ORANGE 81..125 CDD:128787 11/43 (26%)
HES2NP_061962.2 HLH 12..70 CDD:238036 27/57 (47%)
ORANGE 84..127 CDD:128787 12/54 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173 11/48 (23%)
WRPW motif 170..173 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.