DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and E(spl)m5-HLH

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster


Alignment Length:186 Identity:74/186 - (39%)
Similarity:102/186 - (54%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKES 71
            :|||..|.||.||||||:||||:|||||.||.|:||........:.:||::||..:..:|| :..
  Fly    12 VSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMRK-QVV 75

  Fly    72 KKHVPAN--PEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVN 134
            |:..|.:  |..||:.||:.|.:|:||.:|..|.:.|..|.|:|||||:...::.|..:...:|.
  Fly    76 KQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVT 140

  Fly   135 TPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQV----WRPW 186
            |                  |:...:||.||||.||||.....:||..|    ||||
  Fly   141 T------------------STPRPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 29/59 (49%)
ORANGE 81..125 CDD:128787 18/43 (42%)
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 26/51 (51%)
ORANGE 87..131 CDD:128787 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469363
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.