DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and E(spl)mbeta-HLH

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_524505.2 Gene:E(spl)mbeta-HLH / 43152 FlyBaseID:FBgn0002733 Length:195 Species:Drosophila melanogaster


Alignment Length:214 Identity:99/214 - (46%)
Similarity:126/214 - (58%) Gaps:47/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATKYEMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTVQ 63
            |..:.||||||||||||||:||||||||||||||||||:|.||:.|.|:  .:.|||||||:||:
  Fly     1 MVLEMEMSKTYQYRKVMKPMLERKRRARINKCLDELKDIMVECLTQEGEHITRLEKADILELTVE 65

  Fly    64 HLRKLKESKK----------HVPANPE----QSFRAGYIRAANEVSRALASLPRVDVAFGTTLMT 114
            |::||:..|:          ...|:|:    :||||||:.||||||:.||::|.|.|..||.||:
  Fly    66 HMKKLRAQKQLRLSSVTGGVSPSADPKLSIAESFRAGYVHAANEVSKTLAAVPGVSVDLGTQLMS 130

  Fly   115 HLGMRLNQLE---------QPMEQP---QAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYA 167
            |||.|||.|:         .|::.|   ||:.||....|.|..|.:...:.|..||.|       
  Fly   131 HLGHRLNYLQVVVPSLPIGVPLQAPVEDQAMVTPPPSECDSLESGACSPAPSEASSTS------- 188

  Fly   168 SDNESLLQISSPGQVWRPW 186
                        |.:||||
  Fly   189 ------------GPMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 42/61 (69%)
ORANGE 81..125 CDD:128787 28/52 (54%)
E(spl)mbeta-HLHNP_524505.2 HLH 13..75 CDD:238036 42/61 (69%)
ORANGE 97..141 CDD:128787 28/43 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469354
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
98.900

Return to query results.
Submit another query.