DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and E(spl)mgamma-HLH

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster


Alignment Length:206 Identity:96/206 - (46%)
Similarity:130/206 - (63%) Gaps:33/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTVQHLRKL 68
            ||||||||||||||:||||||||||||||||||||...:...|:  .:.|||||||:||.||:|:
  Fly     8 EMSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEHVTRLEKADILELTVTHLQKM 72

  Fly    69 KESKKHVPAN------PEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQ-- 125
            |:.::|..|:      |.:.||:|||.|.|||||:|:.||.::|:.||.||||||.||||::.  
  Fly    73 KQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLGQRLNQIQPAE 137

  Fly   126 ----PMEQPQAVN-----------TPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQ 175
                |:..|.:|:           :|:|...||.:|:::.:|.|..::|........|::|.   
  Fly   138 KEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSEDEE--- 199

  Fly   176 ISSPGQVWRPW 186
                 .|||||
  Fly   200 -----NVWRPW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 41/61 (67%)
ORANGE 81..125 CDD:128787 27/43 (63%)
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 41/61 (67%)
ORANGE 91..135 CDD:128787 27/43 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469356
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
98.900

Return to query results.
Submit another query.