DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and hes6

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_919381.2 Gene:hes6 / 373116 ZFINID:ZDB-GENE-030828-5 Length:226 Species:Danio rerio


Alignment Length:210 Identity:66/210 - (31%)
Similarity:99/210 - (47%) Gaps:40/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESK----KH 74
            ||..|||:|:|||||||:.|.||:.|:|:..||   .|.|.|::||:||:.:..:.::|    ..
Zfish    20 RKTRKPLVEKKRRARINESLQELRLLLADPDAQ---VKMENAEVLEMTVKRVESILQNKAKEADS 81

  Fly    75 VPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHL--GMRLNQLEQ------------ 125
            |.....:.|.||||:..:||...::|.|.:|......|:.||  .|.||..|:            
Zfish    82 VNREANERFAAGYIQCMHEVHTFVSSCPGIDATIAADLLNHLLECMPLNDEERFQDILSDLISDS 146

  Fly   126 ------PMEQPQAVNTP--LSIVCGSSS----SSSTYSSASSCSSISPVSSGY------ASDNES 172
                  |.|...|..:|  .|:..|.||    :.||.||...||.:....:.:      |.|...
Zfish   147 NNSGTWPGEAAYATLSPGGTSVANGGSSALSPAPSTTSSDDICSDLDDTDTEHSRISVDAGDQAP 211

  Fly   173 LL-QISSPGQVWRPW 186
            :: .:.:...:||||
Zfish   212 VVPTLYTNKSIWRPW 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 28/62 (45%)
ORANGE 81..125 CDD:128787 16/45 (36%)
hes6NP_919381.2 HLH 18..75 CDD:238036 27/57 (47%)
Hairy_orange 90..128 CDD:284859 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.