DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her15.2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001099062.1 Gene:her15.2 / 359836 ZFINID:ZDB-GENE-070627-1 Length:149 Species:Danio rerio


Alignment Length:189 Identity:47/189 - (24%)
Similarity:75/189 - (39%) Gaps:51/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TKYEMSKTYQYRKVMKPLLERKRRARINKCLDELKDLM-AECVAQTGDAKFEKADILEVTV---- 62
            |:|......:..|:.||::|:.||.|||.|:::||.:: .|...|..:||.|||||||:||    
Zfish     7 TEYSKLSNKEKHKLRKPVVEKMRRDRINNCIEQLKSMLEKEFQQQDPNAKLEKADILEMTVVFLK 71

  Fly    63 QHLRKLKESKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPM 127
            |.||         |..|:.:...||.:...|.           ::|.:.....:..||.|..:..
Zfish    72 QQLR---------PKTPQNAQIEGYSQCWRET-----------ISFLSVGSEAVAQRLQQEARRS 116

  Fly   128 EQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW 186
            ..|:..:|                      |.:|    :........:..:...:||||
Zfish   117 AAPELTHT----------------------SEAP----HQQHTHIKQEPRAHAPLWRPW 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 28/64 (44%)
ORANGE 81..125 CDD:128787 7/43 (16%)
her15.2NP_001099062.1 HLH 19..72 CDD:278439 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.