DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Hey

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster


Alignment Length:185 Identity:56/185 - (30%)
Similarity:85/185 - (45%) Gaps:44/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLK----ESKKH 74
            ||..:.::|:|||.|||..|.|||.|:.....:.|.||.|||:||::||:||:.|:    :|..:
  Fly   101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSY 165

  Fly    75 VPANPEQSFR-AGYIRAANEVSRALASLPRVDV--AFGTTLMTHLGMRLNQLEQPMEQPQAVNTP 136
            .|......:. .|:...|.||:|.|.::..:|:  .....||:||...:.|.|            
  Fly   166 DPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRE------------ 218

  Fly   137 LSIVCGSSSSSSTYSSASSCSS------ISPVSSGY-----ASDNESLLQISSPG 180
                          .||.||:|      .:|.||||     |:..:|....::||
  Fly   219 --------------LSAKSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 28/62 (45%)
ORANGE 81..125 CDD:128787 12/46 (26%)
HeyNP_523657.1 HLH 100..156 CDD:238036 26/54 (48%)
ORANGE 172..218 CDD:128787 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.