DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and HES1

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_005515.1 Gene:HES1 / 3280 HGNCID:5192 Length:280 Species:Homo sapiens


Alignment Length:256 Identity:64/256 - (25%)
Similarity:102/256 - (39%) Gaps:91/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTVQHLRKLKESKKH 74
            ::||..||::|::||||||:.|.:||.|:.:.:.:...  :|.|||||||:||:|||.|:.::..
Human    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMT 97

  Fly    75 VPANPEQS----FRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQ---------- 125
            ...:.:.|    :|||:....|||:|.|::...|:....|.|:.||...:.|:..          
Human    98 AALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPA 162

  Fly   126 -------------PMEQPQAVNTPLSIVCGSSSSS------------------------------ 147
                         |...|.|...||..:.|.::..                              
Human   163 LQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDG 227

  Fly   148 ------------------STYSSASSCS----SISPVSSGYASDNESLLQISSPGQVWRPW 186
                              ..|:|.|..|    ::|| |||.:...:|:         ||||
Human   228 QFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSP-SSGPSLTADSM---------WRPW 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 29/61 (48%)
ORANGE 81..125 CDD:128787 15/47 (32%)
HES1NP_005515.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 29/61 (48%)
Hairy_orange 110..148 CDD:400076 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..200 6/42 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..280 11/35 (31%)
WRPW motif 275..278 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140915
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.