Sequence 1: | NP_536753.1 | Gene: | E(spl)m7-HLH / 43160 | FlyBaseID: | FBgn0002633 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955918.3 | Gene: | her8a / 323656 | ZFINID: | ZDB-GENE-030131-2376 | Length: | 221 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 63/204 - (30%) |
---|---|---|---|
Similarity: | 92/204 - (45%) | Gaps: | 33/204 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESKKHVPAN 78
Fly 79 -------PEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHL-------------------- 116
Fly 117 -GMRLNQLEQPMEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPG 180
Fly 181 ---QVWRPW 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m7-HLH | NP_536753.1 | HLH | 13..73 | CDD:238036 | 28/58 (48%) |
ORANGE | 81..125 | CDD:128787 | 15/64 (23%) | ||
her8a | NP_955918.3 | HLH | 17..75 | CDD:238036 | 28/55 (51%) |
Hairy_orange | 95..133 | CDD:284859 | 13/37 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573657 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 92 | 1.000 | Inparanoid score | I5073 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1483774at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.860 |