DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her8a

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_955918.3 Gene:her8a / 323656 ZFINID:ZDB-GENE-030131-2376 Length:221 Species:Danio rerio


Alignment Length:204 Identity:63/204 - (30%)
Similarity:92/204 - (45%) Gaps:33/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESKKHVPAN 78
            ||:.|||:|:|||.|||..|::||.:|.:.. ....:|.||||:||:||||:..|:.......:|
Zfish    20 RKLRKPLIEKKRRERINSSLEQLKGIMVDAY-NLDQSKLEKADVLEITVQHMENLQRGHGQGGSN 83

  Fly    79 -------PEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHL-------------------- 116
                   ..|.:.:|||:..:||...|.|.|.:|...|..|:.||                    
Zfish    84 SPGTGFESRQRYSSGYIQCMHEVHNLLLSCPGMDKTLGARLLNHLLKSLPHISTEPSGTSSAGTS 148

  Fly   117 -GMRLNQLEQPMEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPG 180
             .:.|:..:.|:..|.::.....::..|..||.|:|........||.||.......||... .||
Zfish   149 SPLPLSPTQSPINLPSSLQPHALLLSPSPPSSPTHSLVRPREQSSPPSSPSPQSPASLPPF-FPG 212

  Fly   181 ---QVWRPW 186
               .:||||
Zfish   213 VDPSMWRPW 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 28/58 (48%)
ORANGE 81..125 CDD:128787 15/64 (23%)
her8aNP_955918.3 HLH 17..75 CDD:238036 28/55 (51%)
Hairy_orange 95..133 CDD:284859 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573657
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.