DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Heyl

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001101447.1 Gene:Heyl / 313575 RGDID:1305022 Length:326 Species:Rattus norvegicus


Alignment Length:193 Identity:56/193 - (29%)
Similarity:81/193 - (41%) Gaps:49/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESKKHVP 76
            |.||..:.::|::||.|||..|.||:.|:.....:.|.:|.|||::|::||.||:.|        
  Rat    42 QARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKML-------- 98

  Fly    77 ANPEQSFRAGYIRAANEVSRALASLPRVD---VAFG---TTLMTHLGMRLNQLEQPMEQPQAVNT 135
               ..|..||:..|     ||||    ||   :.|.   |.::.:||:    ||.|......|..
  Rat    99 ---HASGGAGFFDA-----RALA----VDFRSIGFRECLTEVVRYLGV----LEGPSSHADPVRI 147

  Fly   136 PL-----SIVCGSSSSSST----------YSSASSCSSISPVSSGYA----SDNESLLQISSP 179
            .|     |.......|.:|          :|...||..:..:||..|    .....|..:|||
  Rat   148 RLLSHLNSYAAEMEPSPTTTGALAFPVWPWSFLHSCPGLPSLSSQLAILGRVPGPVLPNVSSP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 23/59 (39%)
ORANGE 81..125 CDD:128787 15/49 (31%)
HeylNP_001101447.1 bHLH-O_HEYL 36..109 CDD:381453 27/77 (35%)
ORANGE 115..162 CDD:128787 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334594
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.