DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_005155978.1 Gene:her2 / 30300 ZFINID:ZDB-GENE-980526-274 Length:133 Species:Danio rerio


Alignment Length:176 Identity:49/176 - (27%)
Similarity:74/176 - (42%) Gaps:63/176 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVMKPLLERKRRARINKCLDELKDLM-AECVAQTGDAKFEKADILEVTVQHLRKLKESKKHVPAN 78
            |:.||::|:.||.|||||:::||.|: .|..|....:|.|||||||:.|.:|:...::  |..:.
Zfish    17 KLRKPVVEKMRRDRINKCIEQLKILLKTEIKASQPCSKLEKADILEMAVIYLKNTADA--HARSY 79

  Fly    79 PE---QSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPLSIV 140
            .|   ||:..||.|...|.:|.|::              |            :|.|..:.|:   
Zfish    80 SEAHAQSYADGYSRCIEETARFLSA--------------H------------KQTQKHSKPV--- 115

  Fly   141 CGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW 186
                         .||...|              :|:..| :||||
Zfish   116 -------------DSCQITS--------------EIAKHG-LWRPW 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 26/58 (45%)
ORANGE 81..125 CDD:128787 9/43 (21%)
her2XP_005155978.1 HLH 13..70 CDD:238036 26/52 (50%)
ORANGE 85..133 CDD:128787 19/104 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.