DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her3

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_571155.1 Gene:her3 / 30289 ZFINID:ZDB-GENE-980526-204 Length:229 Species:Danio rerio


Alignment Length:222 Identity:66/222 - (29%)
Similarity:99/222 - (44%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SKTYQYRKVMKPLLERKRRARINKCLDELKDLM-AECVAQTGDAKFEKADILEVTVQHLRKLKES 71
            :|....:||.|||:|:||||||||||::||.|: :.|.......|.|||||||:||:|||.|:.:
Zfish    11 AKPQNVKKVSKPLMEKKRRARINKCLNQLKSLLESACSNNIRKRKLEKADILELTVKHLRHLQNT 75

  Fly    72 KKHV-PANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQ------------- 122
            |:.: .|.....:.|||....|.||..|.: ...|....:.::|:|...||.             
Zfish    76 KRGLSKACDSAEYHAGYRSCLNTVSHYLRA-SDTDRDSRSIMLTNLTSGLNHNRVPDFSTVESDP 139

  Fly   123 ---------LEQPMEQPQAVNTPLSI----------VC--------GSSSSSSTYSSASSCSSIS 160
                     |.:|.:.|  :.|.:|.          ||        |.|...|..::..|..|..
Zfish   140 ALIFTLPSTLRRPHKVP--IRTDVSYSSFQQTAERKVCLMPKRTEIGDSDRMSLDAALRSQESKK 202

  Fly   161 PVSSGYASDNESLLQISSPGQ-VWRPW 186
            ..::.:...:..:::.....| .||||
Zfish   203 AETTHFRPKDLKVIECCIFKQNYWRPW 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 34/60 (57%)
ORANGE 81..125 CDD:128787 13/65 (20%)
her3NP_571155.1 HLH 17..77 CDD:238036 34/59 (58%)
ORANGE 88..129 CDD:128787 12/41 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573642
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.