Sequence 1: | NP_536753.1 | Gene: | E(spl)m7-HLH / 43160 | FlyBaseID: | FBgn0002633 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571154.2 | Gene: | her6 / 30288 | ZFINID: | ZDB-GENE-980526-144 | Length: | 270 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 75/250 - (30%) |
---|---|---|---|
Similarity: | 118/250 - (47%) | Gaps: | 64/250 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MATKYEMSKT-YQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTV 62
Fly 63 QHLRKLKESKKHVPANPEQS----FRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQL 123
Fly 124 --------------------EQPMEQ-----PQAVNTPLS-IVCGSSSSSSTYSSASSC---SSI 159
Fly 160 SPVSSG--------------------YASDNESLLQIS-SPG-------QVWRPW 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m7-HLH | NP_536753.1 | HLH | 13..73 | CDD:238036 | 28/61 (46%) |
ORANGE | 81..125 | CDD:128787 | 14/67 (21%) | ||
her6 | NP_571154.2 | HLH | 32..95 | CDD:238036 | 28/62 (45%) |
Hairy_orange | 110..148 | CDD:284859 | 13/37 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170573738 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.840 |