DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her6

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_571154.2 Gene:her6 / 30288 ZFINID:ZDB-GENE-980526-144 Length:270 Species:Danio rerio


Alignment Length:250 Identity:75/250 - (30%)
Similarity:118/250 - (47%) Gaps:64/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATKYEMSKT-YQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTV 62
            |.|..:..|| .::||..||::|::||||||:.|.:||.|:.:.:.:...  :|.|||||||:||
Zfish    21 MNTTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTV 85

  Fly    63 QHLRKLKESKKHVPANPEQS----FRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQL 123
            :|||.::.::.....|.:.:    :|||:....|||:|.|::...|:....|.|:.||...:.|:
Zfish    86 KHLRNMQRAQMTAALNTDPTVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLASCMTQI 150

  Fly   124 --------------------EQPMEQ-----PQAVNTPLS-IVCGSSSSSSTYSSASSC---SSI 159
                                .|||.|     .||...||| :.|.|.|||:..|.|:..   ..:
Zfish   151 NAMNYPTQHQIPAGPPHPSFSQPMVQIPSATQQANVVPLSGVPCKSGSSSNLTSDATKVYGGFQL 215

  Fly   160 SPVSSG--------------------YASDNESLLQIS-SPG-------QVWRPW 186
            .|.:.|                    ||:::.:.:.:: |||       .|||||
Zfish   216 VPATDGQFAFLIPNAAFAPNGPVIPVYANNSNTPVPVAVSPGAPSVTSDSVWRPW 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 28/61 (46%)
ORANGE 81..125 CDD:128787 14/67 (21%)
her6NP_571154.2 HLH 32..95 CDD:238036 28/62 (45%)
Hairy_orange 110..148 CDD:284859 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573738
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.