DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her1

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_571153.1 Gene:her1 / 30287 ZFINID:ZDB-GENE-980526-125 Length:328 Species:Danio rerio


Alignment Length:330 Identity:69/330 - (20%)
Similarity:110/330 - (33%) Gaps:155/330 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECV--AQTGDAKFEKADILEVTVQHLR-- 66
            :|:.....::::||::|:|||.|||:.|:||:.|:.:..  ::..:.|.|||:|||:.|:::|  
Zfish     5 KMASRRPTKRILKPVIEKKRRDRINQRLEELRTLLLDNTLDSRLQNPKLEKAEILELAVEYIRTK 69

  Fly    67 --------------------------------KLKES--KKHVPANP------------------ 79
                                            .:.||  ..:.|:||                  
Zfish    70 TATARDQGDSSKDTHDPKPPPLLSRRPQMPCASIPESIQTHNSPSNPIYKAGFKECISRSASFID 134

  Fly    80 ------EQSFRAGYIRAANEVSRAL-----ASLP-------------RVDV-------------A 107
                  ..||..|.....:..|.||     :|.|             |.||             :
Zfish   135 CVEPSQRDSFVQGLCHHLDSYSSALPHGRVSSNPTHHPWIPNPELSCRTDVQSIGHMRANPEPYS 199

  Fly   108 FGTTLMTHLGMRLNQLEQP--MEQPQAVNTP------------------LSIVC----------- 141
            :..:|.....|.|:...|.  :..|.:::.|                  ||:.|           
Zfish   200 YANSLYPKSFMHLHPTGQHPYLSPPYSISPPPSPGFSSSSPPFSSSPTYLSVPCQFPFPPSISPH 264

  Fly   142 -GSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQV----------------------- 182
             ..||||||.|:.|..::..||..|      ..||:|||.:|                       
Zfish   265 STDSSSSSTLSTVSLSTTSLPVVPG------PHLQVSSPTRVRFSGSVQSSQPRTLRRALFHNQP 323

  Fly   183 -WRPW 186
             ||||
Zfish   324 LWRPW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 24/97 (25%)
ORANGE 81..125 CDD:128787 14/74 (19%)
her1NP_571153.1 HLH 10..67 CDD:238036 21/56 (38%)
Hairy_orange 118..157 CDD:284859 3/38 (8%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573817
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.