DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Hes1

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_077336.3 Gene:Hes1 / 29577 RGDID:62081 Length:281 Species:Rattus norvegicus


Alignment Length:257 Identity:67/257 - (26%)
Similarity:104/257 - (40%) Gaps:92/257 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTVQHLRKLKESKKH 74
            ::||..||::|::||||||:.|.:||.|:.:.:.:...  :|.|||||||:||:|||.|:.::..
  Rat    33 EHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMT 97

  Fly    75 VPANPEQS----FRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQ---------- 125
            ...:.:.|    :|||:....|||:|.|::...|:....|.|:.||...:.|:..          
  Rat    98 AALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPA 162

  Fly   126 --------------PMEQPQAVNTPL------------SIVC--GSSSSSS-------------- 148
                          |...|.|...||            |..|  ||.:..:              
  Rat   163 LQAPPPPPPSGPGGPQHAPFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPD 227

  Fly   149 --------------------TYSSASSCS----SISPVSSGYASDNESLLQISSPGQVWRPW 186
                                .|:|.|..|    ::|| |||.:...:|:         ||||
  Rat   228 GQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSP-SSGSSLTADSM---------WRPW 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 29/61 (48%)
ORANGE 81..125 CDD:128787 15/47 (32%)
Hes1NP_077336.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 4/10 (40%)
bHLH-O_HES1_4 33..95 CDD:381465 29/61 (48%)
Hairy_orange 110..148 CDD:400076 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..206 7/47 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..281 11/35 (31%)
WRPW motif 276..279 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334586
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.