DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Hes2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_062109.1 Gene:Hes2 / 29567 RGDID:62082 Length:157 Species:Rattus norvegicus


Alignment Length:179 Identity:57/179 - (31%)
Similarity:83/179 - (46%) Gaps:37/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPLLERKRRARINKCLDELKDLMAECV-AQTGD-AKFEKADILEVTVQHLRKLKES--K 72
            :.||.:|||||::||||||:.|.:||.|:...: |:|.. :|.|||||||:||:.||:...|  .
  Rat    12 ELRKSLKPLLEKRRRARINESLSQLKGLVLPLLGAETSRYSKLEKADILEMTVRFLREQPASVCS 76

  Fly    73 KHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPMEQPQAVNTPL 137
            ...|.:.: |:..||......::|.|.:...::.|....|:.||..|                  
  Rat    77 TEAPGSLD-SYLEGYRACLARLARVLPACSVLEPAVSARLLEHLRQR------------------ 122

  Fly   138 SIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW 186
              .......|.|.:|||:.:...||...           ||.| :||||
  Rat   123 --TVSGGPPSLTPASASAPAPSPPVPPP-----------SSLG-LWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 32/63 (51%)
ORANGE 81..125 CDD:128787 10/43 (23%)
Hes2NP_062109.1 HLH 12..69 CDD:238036 30/56 (54%)
ORANGE 84..128 CDD:128787 10/64 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..157 12/44 (27%)
WRPW motif 154..157 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334602
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.