DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Hes7

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038941367.1 Gene:Hes7 / 287423 RGDID:1305914 Length:358 Species:Rattus norvegicus


Alignment Length:168 Identity:51/168 - (30%)
Similarity:77/168 - (45%) Gaps:36/168 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KVMKPLLERKRRARINKCLDELKDLMAECVAQTGD-----AKFEKADILEVTVQHLRKLKESKKH 74
            :::|||:|::||.|||:.|:||:.|:.|   :|.|     .|.|||:|||..|.:||  :.|:..
  Rat    43 EMLKPLVEKRRRDRINRSLEELRLLLLE---RTRDQNLRNPKLEKAEILEFAVGYLR--ERSRVE 102

  Fly    75 VPANPE-------------QSFRAGYIRAANEVSRALASLPRV--DVAFGTTLMTHLGMRLNQLE 124
            .|....             ::.|||. .|.:||.|.:...|.|  |....|.....|.:      
  Rat   103 PPGTARGVGQRREAGGWGARNARAGE-GAGSEVDRGVGERPAVLPDEVNNTRACLSLCL------ 160

  Fly   125 QPMEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPV 162
             |...|..|: |.|.:|..:..:|.  |.....|::||
  Rat   161 -PRCPPLHVH-PASCLCLCARLTSV--SLRPAPSLNPV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 27/62 (44%)
ORANGE 81..125 CDD:128787 12/45 (27%)
Hes7XP_038941367.1 bHLH-O_HES7 44..102 CDD:381468 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334626
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.