DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and HEY2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_036391.1 Gene:HEY2 / 23493 HGNCID:4881 Length:337 Species:Homo sapiens


Alignment Length:205 Identity:58/205 - (28%)
Similarity:90/205 - (43%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKES------K 72
            ||..:.::|::||.|||..|.||:.|:.....:.|.||.|||:||::||.||:.|:.:      .
Human    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFD 113

  Fly    73 KHVPANPEQSFRAGYIRAANEVSRALASLPRVDVA--FGTTLMTHLGMRLNQLE----------- 124
            .|..|....|.  |:.....||:|.|:|:..:|.:  ....|::||.....|.|           
Human   114 AHALAMDFMSI--GFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCATQRE
AAAMTSSMAHH 176

  Fly   125 -QPMEQ----------PQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYA------SDNES 172
             .|:..          |.|:..|    .|..:|.||....|:.|.:.| :.|.|      :..:|
Human   177 HHPLHPHHWAAAFHHLPAALLQP----NGLHASESTPCRLSTTSEVPP-AHGSALLTATFAHADS 236

  Fly   173 LLQISSPGQV 182
            .|::.|.|.|
Human   237 ALRMPSTGSV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 25/64 (39%)
ORANGE 81..125 CDD:128787 13/57 (23%)
HEY2NP_036391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 2/2 (100%)
bHLH-O_HEY2 40..121 CDD:381490 27/71 (38%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 47..116 25/66 (38%)
ORANGE 119..165 CDD:128787 12/47 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 307..337
YRPW motif 327..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.