DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and HEY1

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens


Alignment Length:252 Identity:61/252 - (24%)
Similarity:99/252 - (39%) Gaps:79/252 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAEC----VAQTGDAKFEKADILEVTVQHLRKLKES--K 72
            ||..:.::|::||.|||..|.||:.|:...    |.:.|.||.|||:||::||.||:.|..:  |
Human    50 RKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQVMEQGSAKLEKAEILQMTVDHLKMLHTAGGK 114

  Fly    73 KHVPANP-EQSFRA-GYIRAANEVSRALASLPRVDVA--FGTTLMTHLGMRLNQLE--------- 124
            .:..|:. ...:|: |:.....||:|.|:.:..:|.:  ....|::||....:|.|         
Human   115 GYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQRE
AASGAHAGL 179

  Fly   125 ----------------QPMEQPQ-----------------------------AVNTP-------- 136
                            .|:..||                             |:..|        
Human   180 GHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV 244

  Fly   137 LSIVCGSSSSSSTYSSASSCSSISPVSSG-YASDNESLLQISSP------GQVWRPW 186
            |.:|..:|..|....|:.:..|..|.|.| :...:.:.|..|:|      |:.:|||
Human   245 LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPW 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 26/64 (41%)
ORANGE 81..125 CDD:128787 12/71 (17%)
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 1/1 (100%)
bHLH_SF 41..126 CDD:381792 28/75 (37%)
ORANGE 124..170 CDD:128787 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238 4/37 (11%)
YRPW motif 298..301 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.