DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Bhlhe40

DIOPT Version :10

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_035628.1 Gene:Bhlhe40 / 20893 MGIID:1097714 Length:411 Species:Mus musculus


Alignment Length:207 Identity:56/207 - (27%)
Similarity:91/207 - (43%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EMSKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKE 70
            :..:||   |:...|:|:|||.|||:|:.:||||:.|.:..|.....|||.:||:|::|::.|..
Mouse    48 DSKETY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTN 109

  Fly    71 ---------------------SKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMT 114
                                 |.:::.|..|. |.:|:...|.||.:.||..........:.|:|
Mouse   110 LIDQQQQKIIALQSGLQAGDLSGRNLEAGQEM-FCSGFQTCAREVLQYLAKHENTRDLKSSQLVT 173

  Fly   115 HLGMRLNQLEQ------PMEQ-PQAVN---TPLSIVCGSSSSSS--------TY--SSASSCSSI 159
            ||...:::|.|      |::. |:||:   .|..:..||.....        |:  |......|.
Mouse   174 HLHRVVSELLQGGASRKPLDSAPKAVDLKEKPSFLAKGSEGPGKNCVPVIQRTFAPSGGEQSGSD 238

  Fly   160 SPVSSGYASDNE 171
            :...|||..:.|
Mouse   239 TDTDSGYGGELE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 bHLH-O_ESMB_like 7..73 CDD:381584 27/86 (31%)
ORANGE 81..125 CDD:128787 12/43 (28%)
Bhlhe40NP_035628.1 Essential for interaction with BMAL1, E-box binding and repressor activity against the CLOCK-BMAL1 heterodimer. /evidence=ECO:0000250 1..139 28/93 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
bHLH-O_DEC1 40..129 CDD:381592 26/83 (31%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 3/3 (100%)
ORANGE 140..184 CDD:128787 13/44 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..294 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.