DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Hey1

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_034553.2 Gene:Hey1 / 15213 MGIID:1341800 Length:299 Species:Mus musculus


Alignment Length:245 Identity:61/245 - (24%)
Similarity:100/245 - (40%) Gaps:74/245 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKES--KKHVP 76
            ||..:.::|::||.|||..|.||:.|:.....:.|.||.|||:||::||.||:.|..:  |.:..
Mouse    50 RKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFD 114

  Fly    77 ANP-EQSFRA-GYIRAANEVSRALASLPRVDVA--FGTTLMTHLGMRLNQLE------------- 124
            |:. ...:|: |:.....||:|.|:.:..:|.:  ....|::||....:|.|             
Mouse   115 AHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHGGLGHIP 179

  Fly   125 ------------QPMEQPQ-----------------------------AVNTPLSIVCG------ 142
                        .|:..||                             |:..|.|...|      
Mouse   180 WGSAFGHHPHIAHPLLLPQNGHGNAGTAASPTEPHHQGRLASAHPEAPALRAPPSGGLGPVLPVV 244

  Fly   143 SSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSP------GQVWRPW 186
            :|:|..:....||.:|:|.....::|.:  ||..|:|      |:.:|||
Mouse   245 TSASKLSPPLLSSVASLSAFPFSFSSFH--LLSPSTPTQAANLGKPYRPW 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 25/60 (42%)
ORANGE 81..125 CDD:128787 12/71 (17%)
Hey1NP_034553.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 2/2 (100%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 48..117 27/66 (41%)
HLH 50..107 CDD:238036 25/56 (45%)
ORANGE 120..166 CDD:128787 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..234 4/39 (10%)
YRPW motif 289..292 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830846
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.