Sequence 1: | NP_536753.1 | Gene: | E(spl)m7-HLH / 43160 | FlyBaseID: | FBgn0002633 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034553.2 | Gene: | Hey1 / 15213 | MGIID: | 1341800 | Length: | 299 | Species: | Mus musculus |
Alignment Length: | 245 | Identity: | 61/245 - (24%) |
---|---|---|---|
Similarity: | 100/245 - (40%) | Gaps: | 74/245 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 RKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKES--KKHVP 76
Fly 77 ANP-EQSFRA-GYIRAANEVSRALASLPRVDVA--FGTTLMTHLGMRLNQLE------------- 124
Fly 125 ------------QPMEQPQ-----------------------------AVNTPLSIVCG------ 142
Fly 143 SSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSP------GQVWRPW 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m7-HLH | NP_536753.1 | HLH | 13..73 | CDD:238036 | 25/60 (42%) |
ORANGE | 81..125 | CDD:128787 | 12/71 (17%) | ||
Hey1 | NP_034553.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..53 | 2/2 (100%) | |
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 | 48..117 | 27/66 (41%) | |||
HLH | 50..107 | CDD:238036 | 25/56 (45%) | ||
ORANGE | 120..166 | CDD:128787 | 11/45 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..234 | 4/39 (10%) | |||
YRPW motif | 289..292 | 1/2 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830846 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |