Sequence 1: | NP_536753.1 | Gene: | E(spl)m7-HLH / 43160 | FlyBaseID: | FBgn0002633 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006538625.3 | Gene: | Hes5 / 15208 | MGIID: | 104876 | Length: | 415 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 85/205 - (41%) | Gaps: | 40/205 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 EMSKTYQYRKVMKPLLERKRRARINKCLDELKDLM-AECVAQTGDAKFEKADILEVTVQHLRKLK 69
Fly 70 E-----SKKHVPANPEQSFRAGYIRAANEVSRALASLPR---VDVAFG-----------TTLM-- 113
Fly 114 --THLGMRLNQLEQPMEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQI 176
Fly 177 SSPGQVWRPW 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m7-HLH | NP_536753.1 | HLH | 13..73 | CDD:238036 | 23/65 (35%) |
ORANGE | 81..125 | CDD:128787 | 10/61 (16%) | ||
Hes5 | XP_006538625.3 | bHLH-O_HES5 | 236..292 | CDD:381467 | 22/55 (40%) |
ORANGE | 334..369 | CDD:128787 | 5/34 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167830910 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X1011 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |