DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and her9

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_571948.1 Gene:her9 / 140613 ZFINID:ZDB-GENE-011213-1 Length:291 Species:Danio rerio


Alignment Length:259 Identity:68/259 - (26%)
Similarity:107/259 - (41%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTVQHLRKLK----E 70
            ::||..||::|::||||||:.|.:||.|:.:.:.:...  :|.|||||||:||:|||.|:    .
Zfish    33 EHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRVQMS 97

  Fly    71 SKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQL-----EQP---- 126
            :......|....:|||:....|||:|.|::...|:....:.|:.||...:.|:     .||    
Zfish    98 AALSADTNVLSKYRAGFNECMNEVTRFLSTCEGVNTEVRSRLLNHLSGCMGQMMAMNYPQPAPAQ 162

  Fly   127 ---MEQPQAVNTPLSIVCGSSSSSSTYSSASS----------------------------CSSIS 160
               :.||..|..|.::....:|..|..|.:.:                            .|:.:
Zfish   163 QAHLAQPLHVQLPSTLPINGASMGSKLSPSEAVSPKVFGGFQLVPATDGQFAFLIPNPAFASATT 227

  Fly   161 PVSSGYASD------NESLLQ------ISSPGQ--------------------------VWRPW 186
            ||...||:.      |.|.:|      ::||.|                          |||||
Zfish   228 PVIPLYANASVPVTVNASPVQASSAPTVASPVQGMTSFSGVPQAVSPVGVSAGAESNEPVWRPW 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 29/65 (45%)
ORANGE 81..125 CDD:128787 13/48 (27%)
her9NP_571948.1 HLH 32..93 CDD:238036 29/59 (49%)
Hairy_orange 110..147 CDD:284859 12/36 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.