DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:200 Identity:55/200 - (27%)
Similarity:88/200 - (44%) Gaps:48/200 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKL-----K 69
            ||   |:...|:|:|||.|||:|:.:||||:.|.:..|.....|||.:||:|::||:.|     :
  Rat    44 TY---KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQ 105

  Fly    70 ESKKHVP-ANPEQS-----------FRAGYIRAANEVSRALASL-------PRVDVAFGTTLMTH 115
            :.:|.:. .|.|:|           |.:|:...|.||.:.||..       ||.     ..|::|
  Rat   106 QHQKIIALQNGERSLKSPVQADLDAFHSGFQTCAKEVLQYLARFESWTPREPRC-----AQLVSH 165

  Fly   116 LGMRLNQLEQPMEQPQAVNTPLSIVCGSSSSSSTYSS-ASSCSSI-------------SPVSSGY 166
            |.....||..|...|.  ..|....|.:.:::::.|. .:.|..:             :...|||
  Rat   166 LHAVATQLLTPQVTPG--RGPGRAPCSAGAAAASGSERVARCVPVIQRTQPGTEPEHDTDTDSGY 228

  Fly   167 ASDNE 171
            ..:.|
  Rat   229 GGEAE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 25/64 (39%)
ORANGE 81..125 CDD:128787 15/61 (25%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 31/80 (39%)
ORANGE 129..175 CDD:128787 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.