DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and hes7.2

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002942675.1 Gene:hes7.2 / 100496131 XenbaseID:XB-GENE-486482 Length:243 Species:Xenopus tropicalis


Alignment Length:234 Identity:59/234 - (25%)
Similarity:92/234 - (39%) Gaps:60/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSKTYQYR---KVMKPLLERKRRARINKCLDELKDLMAECVAQTGD-----AKFEKADILEVTVQ 63
            |..:|..|   ::|||::|::||.|||:.|:.|:.|:.|.   |.|     .|.||||||:.||.
 Frog    15 MRNSYPNREDKRLMKPVIEKRRRDRINQSLEHLRTLLLEA---THDETLKNPKAEKADILKKTVH 76

  Fly    64 HLRKLKESKKHVPANPEQ---SFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQ 125
            .   ||.....||::.::   .|:.|:....|:.:..|.|...:.......::..|...:.|..|
 Frog    77 F---LKMCHNPVPSDGKKLLSGFKGGFREGLNQATSFLNSADSICQKKKEYVVQRLCQHMEQQTQ 138

  Fly   126 P------------MEQPQAVNTP--LSIVCGS--SSSSSTYSSASSCSSISPVSSGYASDNESLL 174
            .            :.|.|.:.:|  :|.|.|:  ..|..|.:|....|.....||.:.:......
 Frog   139 KHCHDSAQDVSSRVNQRQILPSPPLISRVTGNGLEQSPETQTSRPPHSHHPSPSSSFRTPCMGQE 203

  Fly   175 QISSPGQ---------------------------VWRPW 186
            |..:|.|                           |||||
 Frog   204 QQQTPPQTFQANTNKKPTQRTLFPPTSSSVNSALVWRPW 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 27/67 (40%)
ORANGE 81..125 CDD:128787 7/46 (15%)
hes7.2XP_002942675.1 HLH 22..80 CDD:238036 26/63 (41%)
ORANGE 94..138 CDD:128787 7/43 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.