DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and hes6.1

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017949954.1 Gene:hes6.1 / 100126814 XenbaseID:XB-GENE-1018104 Length:195 Species:Xenopus tropicalis


Alignment Length:187 Identity:52/187 - (27%)
Similarity:92/187 - (49%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KPLLERKRRARINKCLDELKDLMAECVAQTGDAKFEKADILEVTVQHLRKLKESK----KHVPAN 78
            |||:|::||||||:.|.:|:.::::...|   :|.|.|::||:||:.:.::..::    ..:...
 Frog    18 KPLVEKRRRARINESLQDLRGILSDTEFQ---SKMENAEVLELTVKRVERILRNRTAEADRLQRE 79

  Fly    79 PEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLE-QPMEQPQAVNTPLSIVCG 142
            ..:.|.||||:..:||...::|.|.:|.:....|:.||      || .|:.:....:..:.::..
 Frog    80 ASERFAAGYIQCMHEVHTFVSSCPGIDASLAAELLNHL------LESMPLSEGSLQDLVMDVLLD 138

  Fly   143 SSSSSS-------TYSSASSCSSI-----SPVSSGYASDNESLLQISSP-GQVWRPW 186
            |:||..       ..||..|||.:     .....|...|:....:|..| ..:||||
 Frog   139 STSSEEGCGLGVLGSSSEDSCSDMEESEGEKAGMGSVQDSGRTPEIQPPTPTMWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 20/58 (34%)
ORANGE 81..125 CDD:128787 15/44 (34%)
hes6.1XP_017949954.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I4979
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1483774at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.