DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m7-HLH and hes5.3

DIOPT Version :9

Sequence 1:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002933894.1 Gene:hes5.3 / 100101782 XenbaseID:XB-GENE-480450 Length:160 Species:Xenopus tropicalis


Alignment Length:190 Identity:51/190 - (26%)
Similarity:81/190 - (42%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATKYEMSK--TYQYRKVMKPLLERKRRARINKCLDELKDLM-AECVAQTGDAKFEKADILEVTV 62
            ::.:|...|  |.|..|:.||::|:.||.|||..:::|::|: .|......|:|.|||||||:.|
 Frog    10 ISREYPADKLTTKQKNKIRKPMVEKMRRDRINSSINQLQNLLEKEFQLLQPDSKPEKADILELAV 74

  Fly    63 QHLRKLKESKKHVPANPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQLEQPM 127
            :.|::...|:........|.|..||....:| :.|..|..|.:......||.|.        |.:
 Frog    75 KFLKQQICSQSKNNRKDYQDFSQGYSNCLHE-TFAFLSFHRTEEEMQLKLMNHF--------QCL 130

  Fly   128 E-QPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQVWRPW 186
            : ||:.::.                |:|......||:|...              :||||
 Frog   131 DSQPRGISV----------------SSSHQKGPGPVASTKI--------------LWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 24/60 (40%)
ORANGE 81..125 CDD:128787 11/43 (26%)
hes5.3XP_002933894.1 bHLH-O_HES5 26..84 CDD:381467 23/57 (40%)
Hairy_orange 93..135 CDD:383064 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.