DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and BHLHE40

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_003661.1 Gene:BHLHE40 / 8553 HGNCID:1046 Length:412 Species:Homo sapiens


Alignment Length:187 Identity:44/187 - (23%)
Similarity:71/187 - (37%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMR---KQVVKQQAPV 81
            |:...|:|::||.|:|:|:..||.|:.|......:..::||.:||..|..::   ..:.:||..:
Human    54 KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKI 118

  Fly    82 SPLP----------------MDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRML 130
            ..|.                .:.|.:|:.....|:.:.:|............::|||......:|
Human   119 IALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELL 183

  Fly   131 QADQVQTSVTTSTP---------RPLSPA--SSG-------------YHSDNEDSQS 163
            |..   ||...|.|         :|.|||  |.|             .||..|.|.|
Human   184 QGG---TSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/54 (31%)
ORANGE 87..131 CDD:128787 7/43 (16%)
BHLHE40NP_003661.1 Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer 1..139 20/84 (24%)
bHLH-O_DEC1 40..129 CDD:381592 20/74 (27%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000269|PubMed:19786558 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 7/43 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..303 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.