DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and BHLHE41

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_110389.1 Gene:BHLHE41 / 79365 HGNCID:16617 Length:482 Species:Homo sapiens


Alignment Length:174 Identity:40/174 - (22%)
Similarity:77/174 - (44%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMR-------- 71
            |:...|:...|:|::||.|:|:|:..||.|:.|......:..::||.:||..|..::        
Human    41 TKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQ 105

  Fly    72 --KQVVKQQ-------APVSPLPMDSFKNGYMNAVSEI----SRVMACTPAMSVDVGKTVMTHLG 123
              ::::..|       :|:.. .:|:|.:|:.....|:    ||..:.||.....|  .::.||.
Human   106 QHQKIIALQNGERSLKSPIQS-DLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCV--QLINHLH 167

  Fly   124 VEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASP 167
            ....:.|...|:.|.....:....:|:::|         |||:|
Human   168 AVATQFLPTPQLLTQQVPLSKGTGAPSAAG---------SAAAP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/61 (28%)
ORANGE 87..131 CDD:128787 11/47 (23%)
BHLHE41NP_110389.1 bHLH-O_DEC2 31..122 CDD:381593 19/80 (24%)
Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269|PubMed:19786558 67..71 2/3 (67%)
ORANGE 129..175 CDD:128787 11/47 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.