DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Bhlhe41

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_077789.1 Gene:Bhlhe41 / 79362 MGIID:1930704 Length:410 Species:Mus musculus


Alignment Length:200 Identity:43/200 - (21%)
Similarity:81/200 - (40%) Gaps:59/200 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 STTFVSKTQHYLK-------VKKP--LLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEML 63
            |:.::.|.:..||       .|.|  |:|::||.|:|:|:..||.|:.|......:..::||.:|
Mouse    25 SSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVL 89

  Fly    64 EAALVFMR----------KQVVKQQ-------APVSPLPMDSFKNGYMNAVSEISRVMA------ 105
            |..|..::          ::::..|       :||. ..:|:|.:|:.....|:.:.:|      
Mouse    90 ELTLKHLKALTALTEQQHQKIIALQNGERSLKSPVQ-ADLDAFHSGFQTCAKEVLQYLARFESWT 153

  Fly   106 -----CTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAA 165
                 |...:|         ||.....::|            ||:..|...||....:..:.:|:
Mouse   154 PREPRCAQLVS---------HLHAVATQLL------------TPQVPSGRGSGRAPCSAGAAAAS 197

  Fly   166 SPKPV 170
            .|:.|
Mouse   198 GPERV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/70 (27%)
ORANGE 87..131 CDD:128787 9/54 (17%)
Bhlhe41NP_077789.1 bHLH-O_DEC2 31..122 CDD:381593 22/90 (24%)
ORANGE 129..175 CDD:128787 10/66 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..255
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.