DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Hes5

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:211 Identity:45/211 - (21%)
Similarity:82/211 - (38%) Gaps:58/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPQSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLV-AEFQGDDAILRMDKAEMLE 64
            ::|:..|            :::||::|:.||.|:|..::.||.|: .||.......:::||::||
  Rat    11 LSPKEKN------------RLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILE 63

  Fly    65 AALVFMRKQ----------------VVKQQAPVSPLPM--------------DSFKNGYMNAVSE 99
            .|:.:::..                ....:||:.||.:              ..:..||...:.|
  Rat    64 MAVSYLKHSKGELGACARVLLPTGVAPTARAPLMPLGLPTAFAAAAGPKSLHQDYSEGYSWCLQE 128

  Fly   100 ISRVMACTPAMSVDVGKTVMTHLGVEFQR--MLQADQVQTSVTTSTPRPLSPASSGYHSDNEDSQ 162
              .|...|...:.|....::.|    |||  ...|...:|....:.|:|...::....|.:...|
  Rat   129 --AVQFLTLHAASDTQMKLLYH----FQRPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQ 187

  Fly   163 SAASPKPVEETMWRPW 178
            ||..       :||||
  Rat   188 SACG-------LWRPW 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/52 (33%)
ORANGE 87..131 CDD:128787 10/45 (22%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 17/55 (31%)
ORANGE 116..158 CDD:128787 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.