DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and bhlhe40

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_004914192.2 Gene:bhlhe40 / 779502 XenbaseID:XB-GENE-486416 Length:385 Species:Xenopus tropicalis


Alignment Length:188 Identity:43/188 - (22%)
Similarity:71/188 - (37%) Gaps:42/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAILRMDKAEMLEAALVFMR---KQV 74
            ||...| |:...|:|::||.|:|:|:..||.|:.|......:..::||.:||..|..:|   ..:
 Frog    70 SKQDTY-KLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVRSLSSLI 133

  Fly    75 VKQQAPVSPLPMDS------------FKNGYMNAVSEISRVMACTPAMSVDVG---KTVMTHL-- 122
            .:||..:..|...|            |.:|:.....|..|.:.         |   |.::.||  
 Frog   134 EQQQQQILTLQSGSPSEENRISAEEMFHSGFQLCAEEALRFLQ---------GGERKELVAHLHR 189

  Fly   123 ------GVEFQRMLQADQVQTSVTTSTP-----RPL-SPASSGYHSDNEDSQSAASPK 168
                  ...|.::.:....:...|...|     .|| |...||..:|.:......:.|
 Frog   190 VASKLGPASFPKVTEKPVPKVQATNCVPVICRAAPLPSGEQSGTDTDTDSGYGGEADK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 18/54 (33%)
ORANGE 87..131 CDD:128787 10/66 (15%)
bhlhe40XP_004914192.2 bHLH_SF 61..151 CDD:412148 25/81 (31%)
Hairy_orange 160..192 CDD:400076 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.