DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and hes2.2

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001038818.1 Gene:hes2.2 / 751634 ZFINID:ZDB-GENE-060825-55 Length:172 Species:Danio rerio


Alignment Length:181 Identity:53/181 - (29%)
Similarity:76/181 - (41%) Gaps:40/181 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDD--AILRMDKAEMLEAALVFMRKQVVKQQAPVS 82
            |..|||||::||||:|..||.||.|:....|.|  ...:::||::||..:.|:..   .|..|..
Zfish    10 KTLKPLLEKKRRARINDSLDRLKALILPLTGKDNCRYSKLEKADILEMTVRFLTD---IQTTPSK 71

  Fly    83 PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTP--- 144
            ...: ||..||...   :.||.|..|..|:|          .|.:..:. |.:|.||...||   
Zfish    72 DTAV-SFTEGYTTC---LQRVSARLPQTSLD----------AETRHRVN-DFIQRSVMPKTPACQ 121

  Fly   145 -----------------RPLSPASSGYHSDNEDSQSAASPKPVEETMWRPW 178
                             :.|..:||...:..:|..|...|.|:...:||||
Zfish   122 NCCAQSSRMMSQIQQKLQNLKSSSSRSTNPKQDILSRPEPVPLITEVWRPW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 23/53 (43%)
ORANGE 87..131 CDD:128787 11/43 (26%)
hes2.2NP_001038818.1 HLH 6..67 CDD:238036 23/59 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573784
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.