DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and Hes3

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_073178.1 Gene:Hes3 / 64628 RGDID:621339 Length:175 Species:Rattus norvegicus


Alignment Length:188 Identity:39/188 - (20%)
Similarity:68/188 - (36%) Gaps:48/188 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LERQRRARMNKCLDTLKTLVAEFQGDDAILR-MDKAEMLEAALVFMRK-QVVKQQAPVSPLPMDS 88
            :|::||||:|..|:.|::|:..........| ::||::||.::.::|. |...|...:.|..:| 
  Rat     1 MEKKRRARINLSLEQLRSLLERHYSHQIRKRKLEKADILELSVKYVRSLQNSLQGLWLVPSGVD- 64

  Fly    89 FKNGYMNAV---------SEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTP 144
            :.:|:...:         .|....:.|...:....|.|.            .:...||:...|..
  Rat    65 YPSGFRGGLPGSSQRLRPGEDDSGLRCPLLLQRRAGSTT------------DSANPQTASVLSPC 117

  Fly   145 RPL----SPASSGYHSDN----------EDSQSAASPKPVEE----------TMWRPW 178
            .|.    .|.:.|..|..          |.|....:|.|...          .:||||
  Rat   118 LPAIWAPGPPAGGSQSPQSPFPPLGGLLESSTGILAPPPASNCQAENPRPGFRVWRPW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 14/46 (30%)
ORANGE 87..131 CDD:128787 6/52 (12%)
Hes3NP_073178.1 bHLH-O_HES3 1..55 CDD:381503 16/53 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..175 9/50 (18%)
WRPW motif 172..175 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.