DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and her7

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_021331987.1 Gene:her7 / 58132 ZFINID:ZDB-GENE-000427-6 Length:221 Species:Danio rerio


Alignment Length:198 Identity:49/198 - (24%)
Similarity:88/198 - (44%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDD----AILRMDKAEMLEAALVFMRK--QVVK 76
            :||:.||.:||:||.|||:.|:.||.|:  .||.:    ...|::|||:||..::|::|  :..|
Zfish    28 FLKLLKPQVERRRRERMNRSLENLKLLL--LQGPEHNQPNQRRLEKAEILEYTVLFLQKANKASK 90

  Fly    77 QQAPVSPLPMDSFKNGYMNAVSEISRV-------------MACT----PAMSVDV-GKTVMTHLG 123
            ::....   ...|..|:.:.:.:.:|.             |.|.    |.:.:.| |.:...|..
Zfish    91 EEEGEE---KSQFMEGFSSCLQKAARFLLEEGGLEGSVTSMLCQRLAHPTIRLPVRGHSRKQHAE 152

  Fly   124 VEFQRMLQADQVQTSVT--------TSTPRPLSPASSGYHSDNEDSQSAAS-----PKPVEETMW 175
            ...|...:....:.:|:        .:|..|.:..::...:|:....|.|.     |:|..:|:|
Zfish   153 SNPQHHARRPHHKNTVSKAGHPSACRNTKEPQASRAAFRSTDSNTKHSTAQPTSRHPEPASQTVW 217

  Fly   176 RPW 178
            |||
Zfish   218 RPW 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 23/55 (42%)
ORANGE 87..131 CDD:128787 10/61 (16%)
her7XP_021331987.1 Hairy_orange 100..135 CDD:311465 5/34 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573661
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.