DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and her8.2

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:214 Identity:58/214 - (27%)
Similarity:101/214 - (47%) Gaps:50/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSNNSTTFVSKTQHYLKVKKPLLERQRRARMNKCLDTLK-TLVAEFQGDDAILRMDKAEMLEAAL 67
            |.|:....:|..:. .|::|||:||:||.|:|.|||.|: |:||.|:.|.:  :::||::||..:
Zfish     9 QQNSCQLHISSKEE-RKLRKPLIERKRRERINLCLDQLRETVVAVFKPDQS--KLEKADILEMTV 70

  Fly    68 VFMRKQVVKQQAPVSPLPMDS-----FKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQ 127
            ..::.   .|.:.||...:::     :..||:..:.|:..::.....|...:|..::.||   |:
Zfish    71 KHLQN---IQSSRVSDPVLNTGARQRYSTGYIQCMQEVHNLLHSCDWMDKTLGSRLLNHL---FK 129

  Fly   128 RM-LQADQV----QTSVT----------------TSTPRPLSPASSGY------HSDNEDSQSAA 165
            .: |.|...    :||:|                |::|:|.|  ||.:      .|.|:......
Zfish   130 SLPLSAKDCPRLPKTSLTSVPSDHSEYSSFHVDETASPKPCS--SSPFLCKRPNQSQNQHFTPIR 192

  Fly   166 SPKPVEET------MWRPW 178
            .|..||.:      |||||
Zfish   193 MPHDVESSHLSVLQMWRPW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 23/52 (44%)
ORANGE 87..131 CDD:128787 8/49 (16%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 23/62 (37%)
Hairy_orange 94..132 CDD:284859 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.