DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and hes2.1

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_021333940.1 Gene:hes2.1 / 559147 ZFINID:ZDB-GENE-081104-104 Length:195 Species:Danio rerio


Alignment Length:205 Identity:60/205 - (29%)
Similarity:92/205 - (44%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PQSNNSTTFVS--KTQHYL-KVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDA--ILRMDKAEM 62
            |.|..|...|:  |..|.| |..|||:|::||||:|..|:.||||:....|.||  ..:::||::
Zfish    11 PHSFGSRMTVAQRKEAHELRKTLKPLMEKRRRARINDSLNHLKTLILPLVGKDASRYSKLEKADI 75

  Fly    63 LEAALVFMR---KQVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVD------VGKTV 118
            ||..:.|:|   ....|.|.       ||:|.||...:..||.::   |..:::      |.:.:
Zfish    76 LEMTVRFLRDLPSSSAKGQT-------DSYKEGYKACLQRISTML---PQSNLETEAHQRVSEFI 130

  Fly   119 MTHLG----------VEFQRML-QADQVQTSV--TTSTPRPLS--PASSGYHSDNEDSQSAASPK 168
            ...:.          .:..:|: |..|...|:  ..|...|:|  ||         .||...:|:
Zfish   131 QQSMASSSSSCQNCCAQNSKMISQMHQRLVSLRNNNSMENPISTVPA---------PSQPQPAPQ 186

  Fly   169 PVEETMWRPW 178
            ..|: |||||
Zfish   187 AAED-MWRPW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 24/56 (43%)
ORANGE 87..131 CDD:128787 10/60 (17%)
hes2.1XP_021333940.1 HLH 30..86 CDD:306515 24/55 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.