DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and HES2

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:169 Identity:51/169 - (30%)
Similarity:83/169 - (49%) Gaps:20/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KVKKPLLERQRRARMNKCLDTLKTLVAEFQG--DDAILRMDKAEMLEAALVFMRKQVVKQQAPVS 82
            |..|||||::||||:|:.|..||.|:....|  :....:::||::||..:.|:::.........:
Human    15 KSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAA 79

  Fly    83 PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQR----MLQADQVQTSVTTST 143
            |||.||::.||...|:.::||:.....:...|...::.||   ::|    .|...:...|...|.
Human    80 PLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHL---WRRAASATLDGGRAGDSSGPSA 141

  Fly   144 PRPLSPASSGYHSDNEDSQSAASPKPVEET----MWRPW 178
            |.| :|||:      .:..||..|.|....    :||||
Human   142 PAP-APASA------PEPASAPVPSPPSPPCGPGLWRPW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 21/53 (40%)
ORANGE 87..131 CDD:128787 11/47 (23%)
HES2NP_061962.2 HLH 12..70 CDD:238036 21/54 (39%)
ORANGE 84..127 CDD:128787 11/45 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173 14/51 (27%)
WRPW motif 170..173 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140926
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5317
OMA 1 1.010 - - QHG47782
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.