Sequence 1: | NP_524511.1 | Gene: | E(spl)m5-HLH / 43158 | FlyBaseID: | FBgn0002631 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001011194.1 | Gene: | hes1 / 496617 | XenbaseID: | XB-GENE-487995 | Length: | 267 | Species: | Xenopus tropicalis |
Alignment Length: | 250 | Identity: | 54/250 - (21%) |
---|---|---|---|
Similarity: | 101/250 - (40%) | Gaps: | 74/250 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 PQSNNSTTFVSKT-QHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEMLE 64
Fly 65 AALVFMRK-QVVKQQAPVS--PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHL---- 122
Fly 123 ------GVEFQRMLQAD------------QVQTSVTTSTPRPLS--------------------P 149
Fly 150 ASSG--------------------YHSDNEDS------QSAASPKPVEETMWRPW 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m5-HLH | NP_524511.1 | HLH | 20..72 | CDD:238036 | 19/53 (36%) |
ORANGE | 87..131 | CDD:128787 | 8/53 (15%) | ||
hes1 | NP_001011194.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..45 | 9/26 (35%) | |
bHLH-O_HES1_4 | 33..95 | CDD:381465 | 21/61 (34%) | ||
Hairy_orange | 110..148 | CDD:369405 | 7/37 (19%) | ||
WRPW motif. /evidence=ECO:0000255 | 264..267 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |