DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and her11

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001003886.1 Gene:her11 / 445409 ZFINID:ZDB-GENE-040824-4 Length:274 Species:Danio rerio


Alignment Length:164 Identity:39/164 - (23%)
Similarity:80/164 - (48%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NSTTF-VSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAIL--RMDKAEMLEAALV 68
            ::.|| ::||:...:..||::|::||.|:|..||.|:.|:.:...|..:.  :::|||:|:.|:.
Zfish     3 STPTFNMTKTEGIKRRLKPVIEKKRRDRINHNLDALRDLLFKNTADTRLQNPKLEKAEILDLAVQ 67

  Fly    69 FMRKQVVKQQAPVSPLPMD--SFKNGYMNAVSEISRVMACTPAMSVDVGK--------TVMTHLG 123
            :::|.:.|.:...:...||  |.:|.::        :....|..:.|..:        .|:.:||
Zfish    68 YIKKTIRKTETARNSNQMDCKSTQNQFV--------ISPAGPLYTSDYCRRFKTSEQNEVLLNLG 124

  Fly   124 VEFQRMLQADQVQTSVTTSTPRPLSPASSGYHSD 157
            |. |.:..:.:....:.:.....|||....||.:
Zfish   125 VS-QNLSGSSKTGNKLVSQKGFLLSPPGQNYHQE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 17/53 (32%)
ORANGE 87..131 CDD:128787 10/53 (19%)
her11NP_001003886.1 HLH 16..71 CDD:238036 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.