DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and E(spl)m3-HLH

DIOPT Version :10

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:227 Identity:68/227 - (29%)
Similarity:104/227 - (45%) Gaps:67/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVAEF--QGDDAILRMDKAEMLEAALVFMRKQV 74
            :|||..|.||.||||||:||||:|||||.||.|:.|.  |..:.:.|::||::||..:..|||  
  Fly     5 MSKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRK-- 67

  Fly    75 VKQQ---------APVSPLP-------MDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLG 123
            :||:         |.|...|       ::||::||::|..:|::|:..| ..:.::|:.:|..|.
  Fly    68 LKQRGGLSLQGVVAGVGSPPTSTSTAHVESFRSGYVHAADQITQVLLQT-QQTDEIGRKIMKFLS 131

  Fly   124 ---VEFQRML------QADQVQTSVTTSTPRPLSPASSGY------------------------- 154
               :|.|..|      |....|..:..|:.|...|...||                         
  Fly   132 TRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVT 196

  Fly   155 --------HSDNEDSQSAASPKPVEETMWRPW 178
                    .:.:..||.:.:.:||    ||||
  Fly   197 SVDGNALSETASVSSQESGASEPV----WRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 bHLH-O_ESM5_like 20..78 CDD:381486 31/59 (53%)
ORANGE 87..131 CDD:128787 14/52 (27%)
E(spl)m3-HLHNP_524509.2 bHLH-O_ESMB_like 5..71 CDD:381584 35/67 (52%)
ORANGE 96..136 CDD:128787 11/40 (28%)

Return to query results.
Submit another query.