DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and E(spl)mgamma-HLH

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_524504.2 Gene:E(spl)mgamma-HLH / 43151 FlyBaseID:FBgn0002735 Length:205 Species:Drosophila melanogaster


Alignment Length:203 Identity:72/203 - (35%)
Similarity:107/203 - (52%) Gaps:42/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VSKTQHYLKVKKPLLERQRRARMNKCLDTLKTLVA---EFQGDDAILRMDKAEMLEAALVFMRKQ 73
            :|||..|.||.||:|||:||||:|||||.||.|:.   |.:|:. :.|::||::||..:..::| 
  Fly     9 MSKTYQYRKVMKPMLERKRRARINKCLDELKDLMVATLESEGEH-VTRLEKADILELTVTHLQK- 71

  Fly    74 VVKQQ-------APVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQ 131
             :|||       ...|..|.:.|::||::||:|:||.::..|.|:|.:|..:|||||   ||:.|
  Fly    72 -MKQQRQHKRASGDESLTPAEGFRSGYIHAVNEVSRSLSQLPGMNVSLGTQLMTHLG---QRLNQ 132

  Fly   132 ADQVQTSVTTSTPR-------------PLSPASSGYHSDNEDSQSAA-------------SPKPV 170
            ....:..|...|..             |:||.||...|.|.::.|.:             .....
  Fly   133 IQPAEKEVLPVTAPLSVHIANRDAYSVPISPISSYAGSPNSNTSSTSHSLLTTIDVTKMEDDSED 197

  Fly   171 EETMWRPW 178
            ||.:||||
  Fly   198 EENVWRPW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 26/54 (48%)
ORANGE 87..131 CDD:128787 19/43 (44%)
E(spl)mgamma-HLHNP_524504.2 HLH 15..77 CDD:238036 31/64 (48%)
ORANGE 91..135 CDD:128787 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469361
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5073
Isobase 1 0.950 - 0 Normalized mean entropy S5317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.