DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and helt

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_996948.1 Gene:helt / 404275 ZFINID:ZDB-GENE-040824-6 Length:270 Species:Danio rerio


Alignment Length:169 Identity:37/169 - (21%)
Similarity:67/169 - (39%) Gaps:41/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VKKPLLERQRRARMNKCLDTL-KT----LVAEFQGDDAILRMDKAEMLEAALVFMRK-------- 72
            |...::|::||.|:|:||:.| ||    |..:..|     :::|||:||..:.::|.        
Zfish    62 VSHKVIEKRRRDRINRCLNELGKTVPMALAKQNSG-----KLEKAEILEMTVQYLRALHSADFPR 121

  Fly    73 -----QVVKQQAPVSPLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQA 132
                 :::.:.|       :.|..||...:..:  |...|....::...|....:....|..:..
Zfish   122 GREKGELLTEFA-------NYFHYGYHECMKNL--VHYLTTVERMETKDTKYARILAFLQSKVVT 177

  Fly   133 DQVQTSVTTSTPRPLSPASSGYHSDNEDSQSAASPKPVE 171
            :.|..|:.|.:|.|         :|........||.|.|
Zfish   178 EPVFGSLGTISPDP---------TDLLCQLEYQSPSPTE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 18/55 (33%)
ORANGE 87..131 CDD:128787 7/43 (16%)
heltNP_996948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
HLH 62..115 CDD:278439 19/57 (33%)
Hairy_orange 136..173 CDD:284859 6/38 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.