Sequence 1: | NP_524511.1 | Gene: | E(spl)m5-HLH / 43158 | FlyBaseID: | FBgn0002631 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_988870.1 | Gene: | hes4 / 394465 | XenbaseID: | XB-GENE-487830 | Length: | 281 | Species: | Xenopus tropicalis |
Alignment Length: | 265 | Identity: | 56/265 - (21%) |
---|---|---|---|
Similarity: | 105/265 - (39%) | Gaps: | 88/265 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 APQSNNSTTFVSKT-QHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEML 63
Fly 64 EAALVFMRK-QVVKQQAPVS--PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHL--- 122
Fly 123 -----GVEFQRMLQADQ-VQTSVTTSTPRP-----------------------LSPASSG----- 153
Fly 154 ----------------YHSDNEDSQSA-ASPKPVE----------------------------ET 173
Fly 174 MWRPW 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
E(spl)m5-HLH | NP_524511.1 | HLH | 20..72 | CDD:238036 | 19/53 (36%) |
ORANGE | 87..131 | CDD:128787 | 7/51 (14%) | ||
hes4 | NP_988870.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..44 | 8/26 (31%) | |
bHLH-O_HES1_4 | 33..95 | CDD:381465 | 21/61 (34%) | ||
Hairy_orange | 110..147 | CDD:369405 | 6/36 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 262..281 | 3/18 (17%) | |||
WRPW motif. /evidence=ECO:0000255 | 278..281 | 2/2 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000785 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |