DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(spl)m5-HLH and hes4

DIOPT Version :9

Sequence 1:NP_524511.1 Gene:E(spl)m5-HLH / 43158 FlyBaseID:FBgn0002631 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_988870.1 Gene:hes4 / 394465 XenbaseID:XB-GENE-487830 Length:281 Species:Xenopus tropicalis


Alignment Length:265 Identity:56/265 - (21%)
Similarity:105/265 - (39%) Gaps:88/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 APQSNNSTTFVSKT-QHYLKVKKPLLERQRRARMNKCLDTLKTLVAEFQGDDAI--LRMDKAEML 63
            ||.|:..|....|: ..:.|..||::|::||||:|:.|..||||:.:....|:.  .:::||::|
 Frog    17 APASSAQTPDKPKSASEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKADIL 81

  Fly    64 EAALVFMRK-QVVKQQAPVS--PLPMDSFKNGYMNAVSEISRVMACTPAMSVDVGKTVMTHL--- 122
            |..:..:|. |.|:..|.::  |..:..::.|:...::|::|.::....::.:|...::.||   
 Frog    82 EMTVKHLRNLQRVQMTAALTADPSVLGKYRAGFNECMNEVTRFLSTCEGVNTEVRTRLLGHLSSC 146

  Fly   123 -----GVEFQRMLQADQ-VQTSVTTSTPRP-----------------------LSPASSG----- 153
                 .:.:|:...:.| :...:.:|||.|                       |.||:.|     
 Frog   147 LGQIVAMNYQQPPSSQQPLHVQLPSSTPAPVPMPCKVNPAEAISPKVFQGGFQLVPATDGQFAFL 211

  Fly   154 ----------------YHSDNEDSQSA-ASPKPVE----------------------------ET 173
                            |.:.|..|... .|..||:                            |:
 Frog   212 IPNPAYTTSPGPVIPLYANTNVTSPGGPQSQSPVQGLTTFGHKMPHMAQAVSPLGGSTGADSAES 276

  Fly   174 MWRPW 178
            :||||
 Frog   277 VWRPW 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(spl)m5-HLHNP_524511.1 HLH 20..72 CDD:238036 19/53 (36%)
ORANGE 87..131 CDD:128787 7/51 (14%)
hes4NP_988870.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 8/26 (31%)
bHLH-O_HES1_4 33..95 CDD:381465 21/61 (34%)
Hairy_orange 110..147 CDD:369405 6/36 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281 3/18 (17%)
WRPW motif. /evidence=ECO:0000255 278..281 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000785
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.